PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_042210_agke.t1
Common NameSOVF_042210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family GATA
Protein Properties Length: 283aa    MW: 31386.9 Da    PI: 9.6776
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_042210_agke.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.41.8e-17204237134
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                        C +Cg+ kTp+WR gp+g+ktLCnaCG++y++ +
  Sp_042210_agke.t1 204 CLHCGSEKTPQWRAGPSGPKTLCNACGVRYKSGR 237
                        99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577164.13E-14197259No hitNo description
PROSITE profilePS5011412.716198234IPR000679Zinc finger, GATA-type
SMARTSM004014.6E-15198252IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.4E-14199235IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.90E-15203251No hitNo description
PROSITE patternPS003440204229IPR000679Zinc finger, GATA-type
PfamPF003203.8E-15204238IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MESFDKAARF MDELLDFSSD IGEEESDDEI PGNSSKSHHF LHHHRLNHRR HNRQSPPFAE  60
FVEEELEWIS NKDAFPMVES LVDILPNHPR IASSYNTNHQ SPISVLDNSN SSSSSSANSH  120
LTHGSLNNNN INSNGGRGGN MMLINLSSDF KVPGKARSKH GRKRRKDMLG SQFKCFVYEK  180
KGARKLASSV SASSKSSSTL GRKCLHCGSE KTPQWRAGPS GPKTLCNACG VRYKSGRLCD  240
EYRPASSPTF SSDLHSNSHR KIVEMRRQKM PLTGSGSNSL EIG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1161166RKRRKD
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00377DAPTransfer from AT3G24050Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007034503.17e-70GATA transcription factor 1, putative
TrEMBLA0A0K9RPU00.0A0A0K9RPU0_SPIOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.15e-47GATA transcription factor 1